PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G0725
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 353aa    MW: 39210.7 Da    PI: 6.984
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G0725genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.44.6e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ +++  G+g +W + ++++g++R++k+c++rw++yl
      Gh_A12G0725 14 KGPWSPEEDAKLKAYIEANGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding361.6e-1169112246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +    G+ +W+ Ia+ ++ gRt++++k++w++
      Gh_A12G0725  69 GGFSEEEDNIICSLYISIGSSRWSIIAAQLP-GRTDNDIKNYWNT 112
                      569****************************.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.555962IPR017930Myb domain
SuperFamilySSF466892.77E-2411110IPR009057Homeodomain-like
SMARTSM007171.4E-111364IPR001005SANT/Myb domain
PfamPF002494.4E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-231569IPR009057Homeodomain-like
CDDcd001671.86E-81662No hitNo description
PROSITE profilePS5129420.7963118IPR017930Myb domain
SMARTSM007173.0E-1067116IPR001005SANT/Myb domain
PfamPF002492.5E-1069112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2270118IPR009057Homeodomain-like
CDDcd001671.83E-971112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKAYIE ANGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIRHGG FSEEEDNIIC SLYISIGSSR WSIIAAQLPG RTDNDIKNYW NTKLKKKLLG  120
KQRKVQQARS ASCLSFKQEM KRESENYRVP GMVNQASDWP LLSPPVMPLT STNQDLYLRD  180
QDSIRNILVK LGGRFSDDHP QSSTTSTTTN PMNFRYPFDV SFSQDHQLYE DSMTILSSAS  240
SISPLNSTCS QTNSTTHFSI NQVGGPNDMI QGLDAFQAEL SELIYSNNGF EGLYGTDNMV  300
GGSSTGTSSV ESSSWGDINS LAYPQFVSGF EPCQHQSIPQ VSNFDESSYF GPQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-22141187108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437175.10.0PREDICTED: transcription factor RAX3-like
SwissprotQ9M2Y91e-88RAX3_ARATH; Transcription factor RAX3
TrEMBLA0A0D2PR870.0A0A0D2PR87_G
STRINGPOPTR_0007s14630.11e-139(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29412568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.15e-75myb domain protein 84